Difference between revisions of "Catherinel Notebook1"
(→cadoyle, 17 October 2013) |
(→cadoyle, 18 October 2013) |
||
| Line 1,310: | Line 1,310: | ||
I looked at the transformation with GGA. There were lots of colonies. I am not sure the transformation worked. I performed colony PCR with 2 controls and 10 experimental following this protocol. [http://www.bio.davidson.edu/courses/Molbio/Protocols/ColonyPCR_Screening.html] | I looked at the transformation with GGA. There were lots of colonies. I am not sure the transformation worked. I performed colony PCR with 2 controls and 10 experimental following this protocol. [http://www.bio.davidson.edu/courses/Molbio/Protocols/ColonyPCR_Screening.html] | ||
| − | I looked that experiment with J40 + J303 plated on Tet, Tet + Theo, Tet + Caff. There was no growth on any plates. I put the plates in 30C incubator. | + | I looked at that experiment with J40 + J303 plated on Tet, Tet + Theo, Tet + Caff. There was no growth on any plates. So, I put the plates in 30C incubator. I will check the plates on Sunday for growth. |
| + | |||
| + | I made a 0.4% agarose gel and ran the colony PCR on the gel as well as J404 from digestion. | ||
Revision as of 16:04, 18 October 2013
Back to Main Page of Catherine's Notebook
cadoyle, 25 August 2013
I meet with Dr. Campbell on Wednesday, 21st of August 2013. We discussed finishing up my thesis proposal by adding in the aptamer sequences for caffeine and 3-methylxanthine that I will be designing riboswitches for.
I found caffeine's aptamer from Alpha Diagnostic Intl. Inc [[1]]. I downloaded the paper: File:Ferguson et al. 2004.pdf that characterized the aptamer and obtained the sequence. On Alpha Diagnostic Int. Inc website there is a product data sheet for the caffeine aptamer that will be useful [[2]].
I found the apatmer for 3-methylxanthine from File:Soukop et al. (2000).pdf. I found this paper while I was doing research for my proposal. I read in File:Lee et al. (2010).pdf that the 3-methylxanthien aptamer had been discovered from a mutation in the theophylline aptamer. Lee et al. (2010) cited Soukop et al. (2000) for the characterization of the 3-methylxanthine aptamer. In Soukop et al. (2000) they list two aptamers for 3-methylxanthine. I picked the aptamer with C22 mutation only because it had a stronger affinity for 3-methlyxanthine (Figure 2C) despite Figure 1B showing that it's specificity for 3-methylxanthine is low.
| Name | Sequence | Reference |
|---|---|---|
| Caffeine | 5-GGAUGUCCAGUCGCUUGCAAUGCCCUUUUAGACCCUGAUGAGGAUCAUCGGACUUUGUCCUGUGGAGUAAGAUCG CGAAACGGUGAAAGCCGUAGGUCU-3 | Ferguson et al. (2004) |
| 3-methlyxanthine | 5- AUACCAGCCGAAAGGCCAUUGGCAG-3 | Soukop et al. (2000) |
I find it interesting and concerning that the aptamer for 3-methylxanthine is so short. Maybe the hammerhead ribozyme needs to be added to the sequence. I will check with Dr. Campbell about it.
Also, in my meeting with Dr. Campbell we talked about comparing the structure of theophylline aptamer in Riboswitch D from File:Topp et al. (2010).pdf to the structures of the caffeine aptamer and 3-methylxanthien aptamer in Riboswitch D. M-fold is a web based software that predicts secondary structures of DNA and RNA, which we can use to compare the structures of the aptamers to see if Riboswitch D will work for the other three aptamers.
I read the paper characterizing the software program File:Zuker(2003).pdf to understand what the input and output values mean for the program.
Information on interpreting output results:
Energy dot plot
In the upper triangular region, a dot in row i and column j represents a base pair between the ith and jth bases. The dots represent the superposition of all possible foldings within p% of ΔGmfe, the minimum free energy, where p is the maximium percent deviation from ΔGmfe. Different colors are used to indicate varying levels of suboptimality. The number of colors ranges from two to eight (the default). If n colors are used, the first color indicates base pairs in optimal foldings. These base pairs are also plotted in the lower left triangle (reversing row and column) for emphasis. The remaining n-1 colors are used for base pairs in suboptimal foldings. If ΔGi.j is the minimum of the free energies of all possible structures containing base pair i.j, and if ΔGmfe+(k-2)pΔG/(n-1) < ΔGi.j ≤ ΔGmfe+(k-1)pΔG/(n-1), then color k is used for base pair i.j, for 2 ≤ k ≤ n. When n is 8 (the default), the optimal base pairs are colored in red and black colors base pairs that are least likely to form.
M-Fold Characterization of the Theophylline, Caffiene, and 3-Methylxanthine Aptamers
M-Fold Characterization of the Theophylline, Caffiene, and 3-Methylxanthine Aptamers
M-Fold Server Input (http://mfold.rna.albany.edu/?q=mfold/RNA-Folding-Form):
I used the RNA Folding Form with no constraints. I kept the default values. I selected immediate job since the sequence is short. Also, I kept the default values for output.
Default values for user input describing folding conditions.
Default values for user input describing output conditions.
Theophylline Results: Theophylline Sequence:
Sequence output with number of nucleotide bases, max folds, for window size 5. Window size is determined by program based on sequence length.
Energy Diagram. The optimal energy for optimal folding in -71.8kcal/mol. I,j, k, which define the helix are plotted in integer units of kcal/mol.
Curricular structural plots.
Caffeine Results:
Caffeine Sequence:
Sequence output with number of nucleotide bases, max folds, for window size 3. Window size is determined by program based on sequence length.
Energy Diagram. The optimal energy for optimal folding in -25.6kcal/mol. I,j, k, which define the helix are plotted in integer units of kcal/mol.
Curricular structural plots.
3-Methlyxanthine Results:
3-Methlyxanthine Sequence:
Sequence output with number of nucleotide bases, max folds, for window size 0. Window size id determined by program based on sequence length.
Energy Diagram. The optimal energy for optimal folding in -8.9kcal/mol. I,j, k, which define the helix are plotted in integer units of kcal/mol.
Curricular structural plots.
I put all the structures of the three aptamers together so we can compare their structures.
Conclusion:
None of the aptamers are similar in structure. The second structure of caffeine is slightly similar to the second structure of theophylline. 3-Methylxanthine looks very odd and very different from the rest of the apatmers. I am going to send this information to Dr. Heyer to see if she can help us explain the results.
cadoyle, 26 August 2013
My objective for today is to start designing a method to build riboswitches for caffeine and 3-methlyxanthine.
I can build the riboswitches using Golden Gate Assembly (GGA). Adapting riboswitch D for theophylline from Topp et al. (2010) modified by Becca in the lab during the summer of 2012, I can build riboswitches for the new aptamers.
I looked at Becca's power point and designed a protocol for making a new riboswitch from scratch using GGA.
Outline:
1) Get each part including destination plasmid
2) Perform iPCR on each part
3) Perform GGA
4) Sequence Verify
5) Test
I have a few questions about the method I generated to ask Dr. Campbell: 1) What vector should the riboswitches be cloned into? 2) How do we get the sequence of the aptamer cloned?
Meeting with Dr. Campbell about method to design riboswitches:
The way I had designed the protocol for riboswitch design still utilizes the old method of cloning and PCR. There is no reason to start from scratch to build the riboswtich. We can design primers for anywhere on the existing riboswitch for theophylline and remove the aptamer and replace it with any aptamer we like. We can clone the aptamer upstream of the RBS and screen by size to see if the aptamer is the correct position. Dr. Campbell said that any vector ending in an 8 will work because it has the BSAI removed for GGA.
Therefore, we need to the apatmers sequences for caffeine and 3-methylxanthine to be synthesized. IDT has a product called g-blocks where you can a sequence synthesized but not cloned cheaply. I will pull the aptamer sequences together and send to Dr. Campbell.
What I need to do to move forward: 1) Get sequences to Dr. Campbell for production of G-blocks 2) Design primers to insert aptamers into theophylline riboswitch 3) Design primers to remove theophllyine aptamer 4) I need to send to Dr. Campbell Lee et al. (2010) which I believe contains information on how the location of an RBS effects the affinity of a riboswitch for a metabolite.
I submitted my Thesis Proposal today and should know by Friday if it was approved. Click here to download File:DoyleThesisProposal.doc
cadoyle, 27 August 2013
My objective today is to gather sequences for making G-blocks and design primers to insert the aptamer G-blocks into the existing riboswitch for theophylline.
I emailed Dr. Campbell the Lee et al (2010) paper and he said we needed reference 20 for the theophylline aptamer. Reference 20 is Soukop et al (2000). Relooking at this paper we noticed that there are two aptamers for 3-methylxanthine. From the data it seems that the 3-methylxanthine aptamer with only a C22 has a higher affinity for 3-methylxanthien despite low specificity overall. We decided that it would be better to test both as we are unsure how either will operate in our riboswitch. Therefore, we will have two aptamers for 3-methlyxanthine and 1 for caffeine.
Below is the G-block information and primer design for caffeine, 3-methlyxanthine, and the theophylline riboswitch:
Riboswitch Designs:
Caffeine:
Aptamer Sequence (99mer): ‘5-GGAUGUCCAGUCGCUUGCAAUGCCCUUUUAGACCCUGAUGAGGAUCAUCGGACUUUGUCCUGUGGAGUAAGAUCG CGAAACGGUGAAAGCCGUAGGUCU-3'
Primers to add BSAI:
Caffeine Aptamer For (27mer): GGTCTC A GGAUGUCCAGUCGCUUGCAA BSAI 1bp 20mer of caffeine aptamer
Caffeine Aptamer Rev (27mer):
GGTCTC A UGUCCTUCGGCTTTCUCCGT
BSAI 1bp 20mer of caffeine apatmer
3-methlyxanthine:
Aptamer sequence (25mer): 5- AUACCAGCCGAAAGGCCAUUGGCAG-3
Primers to add BSAI:
3-MethylC22 Aptamer For (20mer): GGTCTC A AUACCAGCCGAAA BSAI 1bp 13mer of 3-methylxanthine
3-MethylC22 Aptamer Rev (19mer): GGTCTC A CTGCCUUTGGCC BSAI 1bp 12mer of 3-methylxanthine
3-Methylxanthine Protoypic Aptamer Sequence: 5’-AUACCAAGC-GAAAGGCCAUUGGAAG-3’
3-Methylprototypic Aptamer For (20mer):
GGTCTC A AUACCAAGC-GAA
BSAI 1bp 13mer of 3-methylxanthine
3-Methylprototypic Aptamer Rev (19mer): GGTCTC A CTTCCUUTGGCCT BSAI 1bp 12mer of 3-methylxanthine
Theophylline: ‘5-ggtgataccagcatcgtcttgatgcccttggcagcaccctgct-3’
Theophylline Aptamer For (27mer): GGTCTC A ggtgataccagcatcgtctt BSAI 1bp 20mer of caffeine aptamer
Theophylline Aptamer Rev (27mer):
GGTCTC A agcagggtgctgccaagggc
BSAI 1bp 20mer of caffeine apatmer
Riboswitch Addition:
BBA_J100065 Gaattcgcggccgcttctagagaaatcataaaaaatttatttgctttgtgagcggataacaattataatagattcaattgtgagcggataacaattactagagatacgactcactataggtaccggtgataccagcatcgtcttgatgcccttggcagcaccctgctaaggtaacaacaagatgctgagacctactagtagcggccgctgcag
Primers to Perform GGA to remove existing aptamer and insert desired aptamer:
For aptamer remover (27mer): GGTCTC A aaggtaacaacaagatgctg BSAI 1bp 20mer of RBS + spacer + GGA prefix
Rev aptamer remover (27mer): GGTCTC A ggtacctatagtgagtcgta BSAI 1bp 20mer of KpnI + Lac Operon
Meeting with Dr. Campbell about Primer design:
Dr. Campbell and I decided that it was better to wait on ordering primers and G-blocks and plan out the design of the riboswitch more carefully. It seems that it is not possible to plug and chug different aptamers into an existing riboswtich but that each riboswitch must be designed methodically.
Our objective is to look at the original paper that characterized the theophylline aptamer and Topp et al (2010) that designed a riboswitch for the aptamer to see if we can rationally design a method to develop a riboswitch for any aptamer.
We generated a few questions about how Zimmerman (1997) developed the original aptamer for theophylline and how Topp et al. (2010) designed a riboswitch for the aptamer:
1) What did Zimmerman do to characterize the apatamer?
2) How did Topp connect the aptamer with the riboswitch?
3) How did Topp get the RBS to fold up and hide in the aptamer?
4) Was the RBS random or specific for the aptamer?
We decided that we could use M-fold to look at the structures of the riboswitches and see why certain designs failed to detect theophylline in Topp et al (2010). Therefore, we are going to try to meet with Dr. Heyer, who is an expert in M-fold to devise a plan. I am going to write Dr. Heyer and email and explain out objectives and send her Topp et al and Zimmerman papers. Also, I will look to answer the following questions 1) Did Topp et al (2010) change the sequence of the previously characterized theophylline aptamer and 2) how did they determine which RBS to use for the theophylline riboswitch.
cadoyle, 28 August 2013
After meeting with Dr. Campbell yesterday 27 August 2013 we decided to write Dr. Heyer and email about getting together for a riboswitch design meeting. I was assigned to write Dr. Heyer and email explaining our goals and questions about rationally designing riboswitches for known aptamers. Below is the email I sent Dr. Heyer with attached PDFs. I am currently waiting Dr. Heyer's response.
Dr. Heyer,
Dr. Campbell and I would like to meet with you to talk about how we can look at the structures of riboswitches for theophylline and determine how they converted aptamers into riboswitches, in hopes to rationally design riboswitches for caffiene, 3-methylxanthine, and xanthine. By looking at the paper Topp et al (2010) we would like to compare and contrast the different riboswitches built and determine 1) how they were able to get the RBS to base pair with the theophylline aptamer and 2) why certain riboswitch structures did not work. We were thinking that we could utilize M-fold to help us understand the differences in the riboswitch designs and how they relate to the folding of the aptamer. In our meeting I will present information on whether 1) Topp et al (2010) changed the sequence of the previously characterized theophylline aptamer and 2) how they determined which RBS to use for the theophylline riboswitch. Attached are three PDF files 1) the Topp et al. (2010) 2) Supplemental for Topp et al (2010) with figures of the designed riboswitches (Becca Evans developed riboswitch D) and methods, and 3) Zimmerman et al. (1997), which originally characterized the theophylline aptamer. Please let us know some times when you are available so we can pick one that works for both of us.
Thanks,
Catherine
Lab Meeting Presentation on Aptamers and Riboswitches:
For Friday's lab meeting (08/30/2013) I am presenting the aims of my project. My main objective is to explain what an aptamer and riboswitch are and how we can use them to detect an unknown metabolite of caffeine.
Aptamer:
An aptamer is short nucleic acid sequence that binds to a specific small molecule or ligand.
I found this great video that explained an aptamer as a dart aiming for a specific point on a target. "A Customized DNA dart" [[3]]
Riboswitch:
A riboswitch is a regulatory segment of a messenger RNA molecule that binds to a small molecule, resulting in a change in production of the proteins encoded by the mRNA.
Characteristics:
-Translational control
-Contains aptamer sequence
-In 5’ untranslated region of mRNA
In my presentation I made two other slides:
1) showing the folding of the riboswitch with the aptamer from Topp et al (2010).
2) a graph showing how different riboswitches detect theophylline in E. coli.
Tomorrow I will finish up power point and post in the lab notebook. I need to add what the goal of my project is and a few more diagrams to explain how riboswitches and aptamers interact.
cadoyle, 29 August 2013
My objective today is to finish lab the presentation and practice the presentation.
I added a slide showing theophylline biosynthesis, caffeine metabolism, and caffeine derivatives with known aptamers.
I will present this final version tomorrow in lab meeting File:LabMeeting08-30-13.pptx
cadoyle, 1 September 2013
My objective today is to read Topp et al. 2010 and Zimmeran 1998 paper to see if I can determine where Topp et al got the RBS used in their riboswitches and if they mutated the aptamer sequence for theophylline.
After Reading Topp et al (2010) and Zimmerman (1998) I found out a few things: 1. The riboswitches tested were generated using a combination of rational design and in vivo screening. 2. Before they started there had already been published theophylline synthetic riboswitches by Lynch et al. (2007). 3. They made a library of random parts and through high-put screening found the riboswitch that optimized the detection of E.coli. 4. The aptamer was not from Zimmerman 1998 but from Zimmeran 2000. It was not mutated. 5. I am still not sure how they choose the RBS but they mention it is important for it to base pair with aptamer 5. Randomized sequences truly are random. 6. Shorter spacing between the RBS and start codon increased specificity.
I am going read two papers by Lynch describing screening protocol and generation of random sequences. Also, I am going to read the paper by Topp and Galivan (2008) that describes a screening method for the riboswithces once you have candidates.
Notes from Lynch et al. (2007): - Lynch uses cassette-based PCR mutagenesis to create 5 different libraries where the distance between the aptamer and the RBS were varied between 4 to 8 bases and the sequence was radonmized fully. It had been shown earlier that longer or shorter spacing resulted in poorly functioning riboswitches.
-Once they had the libraries they tested them using a Miller assay. To be considered a good riboswitch they had to meet four requirments:
(1) showed an activation ratio of greater than 2.0 in two separate determinations (2) displayed a mini- mum level of b-galactosidase activity in the presence of theophylline (an OD420 R 0.04 in the Miller assay, regard- less of cell density) (3) grew normally relative to others in the plate (as represented by OD600) (4) showed consistent results between the two plates. This simple analysis significantly reduced the number of potential candidates, of which greater than 90% were confirmed as functional synthetic riboswitches when assayed individually in larger volumes of culture
- the pairing region between the aptamer and the ribosome binding site is important for riboswitch function.
I need to the read paper on how lynch made the riboswitch (Desaia and Gallivan, 2004).
cadoyle, 2 September 2013
My objective today is to read the original paper that characterized the theophylline riboswitch and make a presentation on how the riboswitch evolved to give to Dr. Campbell and Dr. Heyer tomorrow in our meeting.
Notes: Desaia and Gallivan, 2004: 1. This the first paper published on the theophylline riboswitch 2. Their original design started with trying to insert the mTCT8-4 theophylline aptamer from Zimmerman (2000) 5 bp upstream of the RBS in the 5' untranslated region. 3. The reporter gene used was B-gal 4. The RBS used was Shine-Dalgarno sequence: AGGAGGU 5. To insert the aptamer into the 5' untranslated region they used a primer containing a Kpn1 site, the aptamer, 5bp randomized sequence, and 35 bp overhand of the RBS. 6. To test their riboswitch they transformed the riboswitch into E.coli than plated the cells on media containing theophylline, caffeine, or no small molecule. The riboswitch was more responsive to theophylline but did respond to caffeine. 7. The paper does not tell how but they realized that having the ribsowtch 8bp upstream of the RBS increased the riboswtich specificity.
Notes Lynch et al., 2007: 1. After Desaia and Gallivan published their paper Lynch et al looked to improve the specificity of the ribsowtch and see if they could understand why the riboswitch published by Desaia and Gallivan worked. 2. In the riboswitch by Desaia and Gallivan there is a section of randomized bases. Lynch wanted to see how important these bases are. 3. They used cassette-based PCR mutagenesis to create 5 different libraries in which the distance between the RBS and aptamer varied between 4 and 8 bases and the sequence was completely randomized. 4. Then they performed a high-through put assay where they plated colonies that grew white on X-gal media with no theophylline in cultures o/n containing theophylline. 5. They found two clones that had high B-gal expression in a culture supplemented with theophylline. 6. Both these clones contained the aptamer 8bp upstream of the RBS like Desaia and Gallivan had seen. 7. They also realized that when they used M-fold (They have methods on how they used it) that the RBS base paired with the aptamer and the randomized sequence making the switch in a "off" state. 8. This showed that the RBS being able to bind to the aptamer and their being 8 bp between the RBS and aptamer essential to a functional riboswitch.
Notes: Topp et al. 2010: 1. Now rereading Topp et al. I understand how they came to the design of the final theophylline riboswitch 2. The paper wanted to see if mutating the RBS to make it base pair with the aptamer would increase its affinity. 3. They found that two switches worked best and those switches had more bp to the RBS. They differend in the number of base pairing between RBS and Ribosome
Questions: 1) can you mutate a RBS and it still function? 2) should we use the same RBS? 3) They don't mention why they choose that RBS?
Link to my ppt presentation with figures and data from the papers. File:Riboswitch History.pptx
All the papers I read and used for the Riboswitch History ppt are: File:Desai dissertation.pdf File:Desaia and Galivan Supp.pdf File:DesaiandGallivan(2004).pdf File:Lynchetal.pdf File:Supp Topp(2010).doc File:Topp dissertation.pdf File:Topp(2010.pdf) File:ToppandGallivan.pdf File:Zimmerman1997.pdf File:Zimmerman2000.pdf
cadoyle, 3 September 2013
Today I met with Dr. Campbell and Dr. Heyer and presented my ppt on the Riboswitch History.
Notes from meeting: 1. Dr. Campbell had an idea that we could feed the cells xanthine or 3-methlyxanthine and overload the cells so they will stop theoretically producing xanthine or 3-methylxanthine and go ahead and produce theophylline. It would stop the de-methylation process. 2. After going over the ppt it seems that we can predict the free energy of each aptamer using m-fold. Lynch et al did this to show the on and off switch of the riboswitch for theophylline. 3. There has to be 8 bases between the RBS and aptamer. 4. D riboswitch had 1/2 the base pairing with ribosome than riboswitch E. The specificity of E is greater by it off is not very off. Maybe if we have 5,6, or 7 base pairing the riboswitch would work better.
Plan of action: 1. Verify the results of Lynch et al. using M-fold to see the free energy calculations are correct 2. Design a program that can randomize the 8 bp spacer between the RBS and aptamer creating 65,00 combinations needed for each aptamer. We can run the sequences through M-fold and using the free energy of each known aptamer predict which riboswitch will work. Then we can it synthesized and start testing. 3. In the mean time I will feed the cells xanthine and 3-methylxanthine and see if we get theophylline to be produced. If we give the cells what they might be producing maybe they will make theophylline and not convert it into another metabolite. 4. Also, as a back up there is a riboswitch that can detect 3-methlyxanthien and theophylline and we can use it see if 3-methylxanthine is present.
Tomorrow I will verify Lynch et al. results on M-fold and start writing the pseudo code.
cadoyle, 4 September 2013
My objective today is to run the riboswitches designed by Lynch et al through M-fold to verify the change in free energy they viewed with the riboswitches 8.1 and 8.2 depending on the random bases in the 8bp spacer.
Predicted folding structure of riboswitches 8.1 and 8.2
Computational RNA Folding Protocol Secondary structures of riboswitches were determined using the RNA mFold web server (http://www.bioinfo.rpi.edu/applications/mfold/rna/form1.cgi). Sequences stretching from 5’- end of the theophylline aptamer to 3’-end of the AUG start codon of riboswitches 8.1 and 8.2 were entered and secondary structures were calculated without constraints at 37C with 50% suboptimality.
I confirmed Lynch et al. (2007) results. M-fold yielded 9 and 8 structures respectively. Extending the sequences of 8.1 and 8.2 to the transcription start site increased the number of suboptimal folds, but did not change the structure of the lowest-energy fold. See below for results and figures.
Results for 8.1 Riboswitch:
Inputted sequence:
Results for 8.2 Riboswitch:
Inputted sequence:
Now that we know that the Lynch et al (2007) protocol works I can start writing the code to randomize the sequences and determine the free energy of different riboswitch designs. The free energy needs to be less than the energy of aptamer ensuring binding of the aptamer to the small molecule.
cadoyle, 4 September 2013
My objective today to is write pseudo code for the program that will determine the free energy of the different riboswitches by randomizing the 8 bp spacer. This will allow us to test 65,000 combinations and pick the optimal ones for testing in the lab.
See below for diagram of how the code will operates
cadoyle, 6 September 2013
My objective today is to talk to Dr. Heyer about issues with implementing the code and downloading M-fold. I will be giving a lab presentation on Riboswitch History in lab meeting today.
Notes from meeting with Dr. Heyer: 1. M-fold is not working because I do have have C++ complier. I will have to use a school computer to download one. 2. I probably will not be able to get every possible combination of a 8bp sequence because it would take to much memory. I am going to use the permutations function to generate combinations. 3. Dr. Heyer did not think objects were a good idea.
Dowloading C++ complier: I tired to download the complier but it would not install. I going to have to use a school computer.
cadoyle, 8 September 2013
My objective today is to write all the code expect the part that implements M-fold. Tomorrow I will use M-fold on a school computer.
I got the sequence for the 16sRNA to use in my code from [[4]].
I was able to get a randomize function to make a random number of combinations for the riboswitch sequence. My computer is not bale to perform every combination because it does not have enough memory.
I went the lab to see if the computers there had X-code so I can install M-fold. X-code needs to be updated the computers and I could not install M-fold. I emailed Dr. heyer about getting access.
The code is working except for the part that calls M-fold. I will go tomorrow to the computer lab to try to get M-fold to run.
cadoyle, 9 September 2013
I got access to the computer lab in chambers and will go today to download M-fold.
I downloaded M-fold and successfully installed the program. I tried running the program from the python script and from command line. I was not able to get the program to run. I re-read the manual and googled how to run the program, but could not figure it out. I emailed Dr. Heyer to see if she can help me. I am waiting her response. I will try again tomorrow.
cadoyle, 10 September 2013
Dr. Heyer emailed me about placing ./ in front of the script when I am trying to run on command line. M-fold still did not run when i tried using ./so I emailed her again. I waiting to see if she can meet with me.
I had a meeting with Dr. Campbell today here are the notes: -Xanthine and 3 methylxanthine arrived. -Xanthine is stored at room temperature and 3-methylxanthine is stored at 4C - I will feed the cells 0.5mmM of 3-methlyxanthine and xanthine with 0.5mmM of caffeine and see if we can get the cells to produce theophylline. - Also, we talked about generating a semester long selection process: 1. Putting the riboswitch with a fitness module we could see if e.coli can mutate over time to produce theophylline. 2. I will read about E.coli mutation rates in liquid vs. plate and see if I can design an experiment to test the evolutionary process of e.coli. We will not know how long it will take for E.coli to make theophylline but is worth a shot. If E. coli does produce theophylline we can sequence the genome and then build riboswitches for that sequence.
Tomorrow I will grow liquid cultures of e.coli with the riboswitch and ecdm8 with caffeine, xanthine and 3-methlyxanthine. See figure below. We have three different options for how the riboswitch and ecDM8 can intereact. 1. the riboswitch is on a high copy plasmid, so it will produce more GFP 2. the ecDM8 gene is on the high copy plasmid and should produce more enzyme for converting caffeine to theophylline, 3. both the riboswitch and ecDM8 on the same high copy plasmid. I will test each type of cell in the different media.
cadoyle, 11 September 2013
Dr. Heyer and I meet today. M-fold needs Fortran complier which the school computers do not have. On Friday she will help me install the Fortran complier. Dr. Heyer, also told me that I wrote my program wrong and it will not give every combinations. I will try to rewrite it by Friday.
I started to plan out how I would make all the media to grow E.coli with the riboswitch + ecDM8 to see if we can force the cells to make theophylline by flooding the cell with 3-methlyxanthine or xanthine, which are downstream derivatives of caffeine.
Media: 50mM Xanthine:
We found that xanthine is slightly soluble in water but is freely soluble in NaOH.
I will make 2mls of 50mM Xanthine in 10mM of NaOH
5mM *(1/1000) = 0.05M 2mLs (1/1000) = 0.02L 0.05M * 0.02L = 1 X 10^-4mol 1X 10^-4mol * 152.11g/mol = 0.015g of xanthine in 2ml of NaOH
50mM 3-Methlyxanthine:
We found that 3-methlyxanthine is slightly soluble in water but is freely soluble in NaOH.
I will make 2mls of 50mM 3-methlyxanthine in 10mM of NaOH
5mM *(1/1000) = 0.05M 2mLs (1/1000) = 0.02L 0.05M * 0.02L = 1 X 10^-4mol 1X 10^-4mol * 166.14g/mol = 0.017g of 3-methlyxanthine in 2ml of NaOH
50mM Caffeine:
I will make 20mls of 50mM Caffeine
5mM *(1/1000) = 0.05M 20mLs (1/1000) = 0.02L 0.05M * 0.02L = 1 X 10^-4mol 1X 10^-4mol * 194.2g/mol = 0.194g of caffeine in 20mls of H20
10mM NaOH:
I will make 10mls of 10mM NaOH from 5M stock
10mM *(1/1000) = 0.01M 10mLs (1/1000) = 0.01L (0.01M)(0.5L) = (5M)(x) x= 100ul of 5M NaOH in 49.9mls of dH20
Tomorrow I will make these solutions and inoculate the media with the cells containing the riboswitch and ecdM8 gene.
cadoyle, 12 September 2013
My objective today is to make solutions for inoculations and finish the program.
I made media according to calculations on 11 September 2013. I filter sterilized each solution.
I added antibiotics to LB to make media acceptable for the different high and low copy antibiotic plasmids:
LB + Amp (high copy): Amp (high copy): 100ul in 200mls
LB + Amp (high copy) + chlor (low copy): Amp (high copy): 100ul in 200mls Chlor (low): 147ul in 200mls
LB + Amp (low copy) + Chlor (high copy) Chlor (high): 1000ul in 200mls Amp (low): 40ul in 200mls
Flooding Cell Experiment:
For each cell type there are 6 different experimental conditions: 1) 20ul caffeine + 20ul of dH20 + 2ml LB + antibiotic 2) 40ul of dH20 + 2ml LB + antibiotic 3) 20ul caffeine + 20ul xanthine + 2ml LB + antibiotic 4) 20ul xanthine + 20ul of dH20 + 2ml LB + antibiotic 5) 20ul caffeine + 20ul 3-methlyxanthine + 2ml LB + antibiotic 6) 20ul 3-methlyxanthine + 20ul of dH20 + 2ml LB + antibiotic
I inoculated the following cells into the proper media:
1) J10015 on psB1A8 (high copy): contains ecDM8 + Riboswitch D - Location: Box 5-2 #3 - test tubes are labeled 1-6
2) J119303 on psB4C5 (low copy) + J100079 on psB1A8 (high copy): contains ecDM8 (J119303) +Riboswitch (J100079) - Location: Box 2-4 #83 - test tubes are labeled 7-12
3) J119304 on psB1A8 (high copy) + J100079 on psB4C5 (low copy): contains ecDM8 (J119304) +Riboswitch (J100079) - Location: Box 4-4 #83 - test tubes are labeled 13-18
I grew the cells over night at 37C.
Tomorrow I measure GFP expression of each cell type in the different media conditions
cadoyle, 13 September 2013
My objective today is to tweak the program and measure the GFP fluorescence in each culture I grew overnight to see if theophylline is being made by E.coli.
The program is now working and will produce 65,536 riboswitch combinations. I need to talk to Dr. Heyer about buying Una-fold. After we get Una-fold downloaded I can calculate the free energy and get putative riboswithces.
I measured the GFP fluorescence for each culture grown o/n at 37C that was inoculated on 09/12/13 following this protocol [[5]]
Results:
Here is my lab presentation with a summary of my work this week in the lab:
cadoyle, 14 September 2013
Flooding Cell Experiment Replicate #2: For each cell type there are 6 different experimental conditions: 1) 20ul caffeine + 20ul of dH20 + 2ml LB + antibiotic 2) 40ul of dH20 + 2ml LB + antibiotic 3) 20ul caffeine + 20ul xanthine + 2ml LB + antibiotic 4) 20ul xanthine + 20ul of dH20 + 2ml LB + antibiotic 5) 20ul caffeine + 20ul 3-methlyxanthine + 2ml LB + antibiotic 6) 20ul 3-methlyxanthine + 20ul of dH20 + 2ml LB + antibiotic 7) 20ul 3-methlyxanthine + 20ul of dH20 + 20ul of xanthine + 2ml LB + antibiotic 8) 20ul 3-methlyxanthine + 20ul of dH20 + 20ul of xanthine + 20ul of caffeine + 2ml LB + antibiotic
I inoculated the following cells into the proper media: 1) J10015 on psB1A8 (high copy): contains ecDM8 + Riboswitch D - Location: Box 5-2 #3 - test tubes are labeled 1-6 2) J119303 on psB4C5 (low copy) + J100079 on psB1A8 (high copy): contains ecDM8 (J119303) +Riboswitch (J100079) - Location: Box 2-4 #83 - test tubes are labeled 7-12 3) J119304 on psB1A8 (high copy) + J100079 on psB4C5 (low copy): contains ecDM8 (J119304) +Riboswitch (J100079) - Location: Box 4-4 #83 - test tubes are labeled 13-18 I grew the cells over night at 37C.
Tomorrow I measure GFP expression of each cell type in the different media conditions
cadoyle, 15 September 2013
I read the GFP expression of cultures made on 15 September 2013. See complied results on 16th September 2013.
Flooding Cell Experiment Replicate #3:
For each cell type there are 6 different experimental conditions: 1) 20ul caffeine + 20ul of dH20 + 2ml LB + antibiotic 2) 40ul of dH20 + 2ml LB + antibiotic 3) 20ul caffeine + 20ul xanthine + 2ml LB + antibiotic 4) 20ul xanthine + 20ul of dH20 + 2ml LB + antibiotic 5) 20ul caffeine + 20ul 3-methlyxanthine + 2ml LB + antibiotic 6) 20ul 3-methlyxanthine + 20ul of dH20 + 2ml LB + antibiotic 7) 20ul 3-methlyxanthine + 20ul of dH20 + 20ul of xanthine + 2ml LB + antibiotic 8) 20ul 3-methlyxanthine + 20ul of dH20 + 20ul of xanthine + 20ul of caffeine + 2ml LB + antibiotic 9) 20ul 3-methlyxanthine + 20ul of dH20 + 20ul of xanthine + 2ml LB + antibiotic 10) 20ul 3-methlyxanthine + 20ul of dH20 + 20ul of xanthine + 20ul of caffeine + 2ml LB + antibiotic
I inoculated the following cells into the proper media: 1) J10015 on psB1A8 (high copy): contains ecDM8 + Riboswitch D - Location: Box 5-2 #3 - test tubes are labeled 1-6 2) J119303 on psB4C5 (low copy) + J100079 on psB1A8 (high copy): contains ecDM8 (J119303) +Riboswitch (J100079) - Location: Box 2-4 #83 - test tubes are labeled 7-12 3) J119304 on psB1A8 (high copy) + J100079 on psB4C5 (low copy): contains ecDM8 (J119304) +Riboswitch (J100079) - Location: Box 4-4 #83 - test tubes are labeled 13-18 I grew the cells over night at 37C.
Tomorrow I measure GFP expression of each cell type in the different media conditions
cadoyle, 16 September 2013
I measured the GFP expression of cultures inoculated on the 15th of September 2013. I combined all three replicates into a excel file and graphed the results. See Excel document below. File:GFPFlourescence09-13-16.pptx
I read some articles about E.coli mutation rates and found that 6.64 generations a day for E.coli. It takes 30 generations for a mutation to occur. There are 0.0024 genomic mutations per generation. It would take 40,000 generations for 100 base substitutions. However, these mutation rates are not under selective pressure with built in fitness. One lab at MSU has been testing e.coli mutation rates and has a protocol for mutating e.coli. Their protocol [[6]] takes place over 75 days for accumulation of 500 generations. I was thinking that we could run the experiment for 35 days instead. Also, I think we could do 3 tubes of 5mls for ECDM8 + Riboswitch instead of 1 10ml flask. Each day I could transfer 100ul form each tube into a fresh tube, measure OD and GFP fluorescence, and plate 100ul of plates to detect contamination.
cadoyle, 17 September 2013
Today I meet with Dr. Campbell. Notes for Meeting:
1. Dr. Campbell requested the order for Unafold, which we can use to generate the free energy of each riboswtich sequence. Hopefully it will be here by Friday so we can get started on testing the sequence combinations.
2. We are going to try to perform the Evolution experiment, except we are going to try one with the TetA resistance fitness module and one with the ADHE fitness module. I will outline both protocols and post tomorrow or Thursday in a pptx for lab meeting. - Note: Riboswitch + TetA cells are in box #3-4 #88,89 we have them in psB4C5 and psb2K3
3. Dr. Campbell and I talked about how we would need to determine genomic mutations vs plasmid mutations as well. I will outline in lab presentation.
4. From the Flooding experiment on 09/16/13 it seems that eCDM8 might not be translated or transcribed. We could do a western blot to see if the gene is being translated in E.coli. I will need to look up antibodies and eptitote tags that we can use.
cadoyle, 18 September 2013
My objective today is to draw out the methods for the evolution experiment and make a power point of the procedure for lab meeting. I made the power point see below and sent it to Dr. Campbell. We had multiple email converstaions and decided to email the ppt to. Dr. Eckdhal with the questions we have concerning the experimental controls and media used.
Dr. Eckdahl,
Dr. Campbell and I are planning an experiment where we see if E.coli can naturally mutate over time into mutants that produces theophylline with the tetA and AdhE fitness modules. I have attached a ppt of the experiment. Dr. Campbell and I would like your input on some of the questions we have about controls and the experiment.
Notes About ppt:
I made a powerpoint about the evolution experiment. The first slide is results from the caffeine derivative experiment. The next six slides show plasmid constructs to be transformed into JM1009 and AdhE- cells respectively. Then I show how I will grow 3 tubes of 5mLs with each type of cell and a control without tetA. I make a note about having to test the amount of TetA to add over time. I thought 0.005mMl every three 3 days. The max I believe is 0.05mM that E.coli can handle so we would reach the max at day 36. I will have to play around with it though. Then to see if the mutation happened in the plasmid or genomic DNA I can grow the cells glowing green on chlor+ Amp with not TetA and then grow those colonies that grow on chlor+Amp+tetA.
We have questions about:
Whether we need a control where cells lacking tetA gene are treated the same way?
Whether we need a control where adhE-cells are lacking the adhE plasmid?
Is liquid better than plates?
Should they be grown at 37C or room temperature?
Thanks, Catherine
I will present this pptx in lab meeting and get the labs opinion. File:Lab Meeting 09-21-13.pptx
Also, Dr. Campbell sent the check for Unafold today so we are waiting for the program to arrive so we can start testing switches.
cadoyle, 19 September 2013
My objective today is the look up eptitote tags for detecting if ecdM8 is being translated.
I found these three putative tags. His requires a western blot and GFP and CAT do not. GFP can be detected through fluorescence and CAT can be detected through another assay. I think GFP tag would be the best but sent the information to Dr. Campbell and will see what he thinks.
Price for Monoclonal $294.00 from sigma aldrich Gel is $125.00 from Thermo Scientific
Price for Monoclonal $285.00 from sigma aldrich
Price $317.00 from signma aldrich
Dr. Campbell emailed me back about using e-myc tag. I think we will use e-myc because Dr. Campbell has worked with it and know that it works.
We can order the tag from http://dshb.biology.uiowa.edu/c-myc.
Here is the full amino amino acid sequence for myc:
>sp|P01106|MYC_HUMAN Myc proto-oncogene protein OS=Homo sapiens GN=MYC PE=1 SV=1 MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL RKRREQLKHKLEQLRNSCA
I wil generate a 10bo eptitope tage fromt the sequence based of one Dr. Campbell's papers [[7]]
cadoyle, 20 September 2013
My objective today is to generate the epitope tag sequence for c-myc and develop primers for cloning it downstream of ecdM8.
I based the epitope sequence tag off of Dr. Campbell's paper. I generated a G-block sequence with BsaI sites to by synthesized and primers for GGA and the traditional way of cloning. File:Epitopeprimers.docx
Also, I presented my lab presentation today about the evolution experiment. File:Lab Meeting 09-21-13.pptx
I got great feed back:
1. We all agreed that having all the controls is the most pragmatic and would make the most sense. One can never have to many controls and helps us argue for programmed evolution through the fitness modules.
2. We decided that plates would be a better medium to perform the experiment on. The diffusion of caffeine across the plate could encourage natural selection pressure. Some areas will have higher tetA which could cause a higher number cells to be rewarded in that area. Also, we will be able to visualize what cells produced the mutation unlike in culture where we have a mixture of cells.
3. It would be beneficial to see how low can we go and still detect theophylline with the riboswitch + GFP gene. For example, If the entire 2 mL has to be 50 µM, then the cells may not be able to produce that much theophylline. Perhaps the flow cytometer will detect what we have not so far.
4. I am going to look back at Will DeLoache's thesis where he quantified diffusion on different percent agar plates to see if we can get an insight into how diffusion works on agar plates.
cadoyle, 21 September 2013
My objective today is to read the paper Dr. Campbell sent File:Sb4000146-2.pdf about ecdM8 in E. coli. Also I will look back through the development of the theophylline aptamer to see if the riboswitch ever showed an affinity for 3-methlyxanthine.
Earlier today Dr. Campbell sent an email about diffusion on plates:
I was playing with Micah's model today trying to get a sense of what might be going on with theophylline production.
The question I am grappling with is the diffusion rate of theophylline out of the cells. In Micah's model, the media is not shaken, so cells and theophylline accumulate locally. When I adjusted the settings to have fast diffusion and not much difference in growth or energy levels, the cells almost all die out, but the same event saves the makers every time. A few cells will collect a critical mass of cells and theophylline in a small area, and these survive and thrive. This makes me more convinced that we need to do these experiments on plates instead of liquid media. Can we grow cells on plates in some way to let theophylline accumulate enough to produce detectable GFP? What concentration would we need in plates to detect GFP by eye? If the colonies are really small, we would never see GFP. Is this true for a lawn of bacteria as well?
I know the MWSU students did some plate experiments in the summer of 2013. Todd, could you summarize what your students did this summer and what they found? Did they ever make plates with caffeine added to the molten media, or did they only use disks? Also, did they use all three types of constructs including when eCDM8 was on pSB1An and so was the riboswitch+GFP?
I re-read Will DeLoache's thesis about diffusion rates on agar plates. I had forgotten that the counter-intuitive result was due to the effect agar concentration has on the effectiveness of the antibiotic. High agar concentrations makes ampicillin not work as well. It was not diffusion rate after all.
Dr. C.
We are waiting on the results from MWSU they should arrive Monday.
It does seem clear that we should use plates to perform the directed evolution with E. coli. From Dr. Campbell's email it does not seem that Will DeLoache's thesis will be helpful in determining the diffusion rate. Maybe I could do a similar experiment with caffeine or theophylline for the riboswitch + GFP. I will talk to Dr. Campbell about it.
Notes From Quandt et al. (2013):
-The paper tried to use N7-demethlayion to convert caffeine to xanthine by using a caffeine degradation operon in E.coli.
-They discovered that glutathione S-transferase from Janthinobacterium sp. Marseille was necessary to achieve N7- demethylation activity. E. coli cells with the synthetic operon degrade caffeine to the guanine precursor, xanthine.
- The paper noted that previous attempts to express and characterize NdmC in E. coli were also unsuccessful.
- They reasoned that a missing activity supplied by another protein could be essential for N7- demethylation activity, explaining the lack of full functionality of our synthetic operon in E. coli.
-NdmC had previously been found to copurify with an uncharacterized putative glutathione S-transferase (GST) encoded by orf8 in the CBB5 gene cluster.
-Therefore, thy added gst9 to their operon to see if it restored the activity of of NdmC.
- The addition of gst9 enabled growth for the guaB strain on minimal media agar plates supplemented with caffeine or theobromine.
Dr. Campbell and I agree that we need to clone gst9 into our ecdM8 construct. This could be why ecdM8 might not be translated. A western blot will show whether translation is occurring or not.
I found the gst9 sequence and will have to synthesized. I also developed primers for insertion the gene into the construct.
>ENA|ABR90275|ABR90275.1 Janthinobacterium sp. Marseille glutathione S-transferase ATGATCACGCTTTATGACTATGAACTCTCGGGGAATTGCTACAAGGTGCGGATGCTCCTT TCCATCCTGAAGCTACCGTACACGATAGAGACAGTGGAATTTTTCCCGTCCAGGGAACAT AAATCACCGGCCTTCCTGCGCATCAATCCACTCGGCCAGTTGCCGGTATTGCGCGATGAT GATTTCGTGTTGCGCGATGCCCAGGCCATCCTGGTTTACCTGGCGAACAAATACGACACC AGTTTGACCTGGTATCCGACACATGCGCCCGCCATCCTCGGCCAGGCAAATATGTGGCTC GCGTTTGCCGATGGTTTGACCGGCTCGATTTCCGCTGCACGTTTGCATGATTTGTTTTTT TACGATTTCAATGCAGAGCAATGCCGTGCCCGCGCGCACGAACTACTGCGCATACTGGAC GAACACCTGTGGGCGGCGGAACAAAATGGACATCAATGGCTATGTCCGGCCGCCGCACCC ACCATCGCGGATCTTGCCTGCTTCCCGTATATCGCATTGTCGGATGAAGCCGGCGTTTCA CTACTCGACTACCCGGCGGTACGACGCTGGCTGGACCGTGTCAAACGCATCCCCGGATTC ACCGTCATGTCGGGGATTTTTCCAACCTCAGCTTCCTTCGAGCCGGCCTCACTTGCGGAA GAAACCTGTCAATAA
File:Epitopeprimers.docx - Primer Document
I also, looked back at the paper that originally characterized the theophylline riboswitch before Topp et al. tweaked the ribsowitch to have a greater on and off state and the theophylline riboswtich does bind to 3-methylxanthine. Data came from Desai and Gallivan 2004
Figure 6. Genetic selection experiments for E. coli harboring either the wild-type synthetic riboswitch grown in liquid media with increasing concentrations of chloramphenicol. Data are recorded after 18 h of growth at 37 °C. OD600 is a measure of the cell density of the cultures.
This explains why in the caffeine derivative experiment GFP expression increased when 3-methlyxanthine was added to the cultures (See Lab meeting ppt 09-21-13 or data from 09-17-13).
cadoyle, 22 September 2013
My objective today is to set up an experiment to find out how low can we go and still detect GFP expression in 2mL cultures containing theophylline.
I tested the GFP expression at 0, 0.05, 0.1, 0.2, 0.3, 0.4, 0.5 mM of Theophylline in a 2mL liquid culture. I made 3 X 2mL cultures for each concentration based off the following calculations:
| Concentration mM | 25 mM Stock (ul) | Lb + Amp | dH20 (ul) |
|---|---|---|---|
| 0 | 0 | 2 | 40 |
| 0.05 | 4 | 2 | 36 |
| 0.1 | 8 | 2 | 32 |
| 0.2 | 16 | 2 | 24 |
| 0.3 | 24 | 2 | 16 |
| 0.4 | 32 | 2 | 8 |
| 0.5 | 40 | 2 | 0 |
I inoculated each tube with J100079 (Riboswitch + GFP) in psB1A2 and grew O/N at 37C [[8]]
Tomorrow I will measure the GFP expression of each culture.
cadoyle, 23 September 2013
My objective today is to measure the GFP expression of each culture from 09-22-13 and analyze the data.
I measured the GFP expression of cultures inoculated on the 22th of September 2013. I combined all three replicates into a excel file and graphed the results. See Excel document below. File:GFPFlourescence09-13-16.pptx
It seems that the flouremeter can detect theophylline at each concentration. This indicates that the construct is quite robust and that if theophylline is present we should be able to detect it.
Results: File:GFP-09-23-13.xlsx
Also, I resubmitted my thesis proposal with corrections. File:DoyleThesisProposal.doc
MWSU sent the data from theophylline experiments on plates see blow. The performed the experiment with the riboswitch + GFP on a low copy plasmid. I would like to try the same experiment with the GFP reporter on a high copy number plasmid. I will talk to Dr. Campbell about it.
File:July 5. CDM clones with different plates.pptx
UnaFold arrived today. I will try to install tomorrow
cadoyle, 24 September 2013
My objective to day is to install unafold and plan an experiment to test how much theophylline needs to be present for GFP to be visible on plates.
I downloaded unafold. But have not tested the installation. I will test the installation tomorrow. From the print out it seems that it was installed properly. I will test Riboswitch D from Topp et al. as a control to make sure the program is working.
Today I also meet with Dr. Campbell. Here are my Notes:
We are not going to test the translation of ecdM8 with an eptitote tag. It diverges from the goal. It would be more beneficial to clone gst9 upstream of ecdM8 and see if the cells can process caffeine using GFP expression as a reporter. Ben or a student at MWSU will work on cloning gst9.
We are going to try a similar experiment to MWSU on plates with different theophylline concentrations. However, we will also look at the concentration of tetA and theophylline together to get an idea of how we can better construct our evolution experiment with E.coli.
We are going to ask how much theophylline do cells need to grow with a fixed amount of tetA. I will make a ppt to show the experiment and post today or tomorrow for lab meeting.
cadoyle, 25 September 2013
My objective today is to test UNAFold and to start cultures to test how much theophylline is need to grow with a fixed amount of tetA.
Dr. Campbell and Abbey made plates for me. Therefore, I can start the experiment following the outline in the lab meeting ppt (see 27 September 2013 entry)
I inoculated one Lb + Amp culture with J1190079 and one Lb + Amp + .1mm Theophylline with J119140. I grew the cultures O/N at 37C.
Tomorrow I will use a sterile loop to streak for colony isolation on the plates and see if we can detect GFP expression by eye and cell growth.
UNAFold: UNAFold is installed properly but cannot find ss-mm.pl program. The program is installed but it cannot execute the program. The program is in C++. I will try checking the read out from the installation to see if something was installed wrong. If I cannot figure it out I will send Dr. Heyer and email.
cadoyle, 26 September 2013
My objective today is to figure out what is wrong with una-fold and than streak plates for theophylline experiment.
I tried to re-install una-fold. When I did I got an recursive error. I looked it up online and it means that the fortran complier is not compiling. The computer does not have the fortran complier so I emailed Dr. Heyer about installing the complier. I am waiting her response.
I streaked the cultures with a sterile loop on to plates contain 0, 0.05, 0.1, 0.2, 0.4 mmM of theophylline +Tet and +/- Amp. See ppt on 27 September 2013 for protocol. I grew the cultures o/n at 37C. Plates with tetA were covered in foil to prevent degradation. Tomorrow I will see if GFP expression is visible and if cell growth is visible on plates with tetA.
cadoyle, 27 September 2013
My objective today is to analyze the results from the theophylline experiments.
Looking at cell growth of cells with the promoter+riboswitch+GFP on plates with various concentrations of theophylline It seems that GFP expression is slighlty detectble at 0.05mM and increases as the theophylline concentration increases.
Looking at cell growth of cells with the promoter+riboswitch+tetA on plates with various concentrations of theophylline, a fixed amount of tetA with and without AMP It seems that cell growth is detectable at 0.05mM and increases as the theophylline concentration increases.
This indicates that the lowest concentration of theophylline for good yield of expression is 0.1mM. Also, the production of the reporter gene is robust in the presence of the theophylline. This indicates that ecdM8 probably is not translated or we would see some kind cell growth or GFP expression.
Here is my lab presentation with the protocol and results File:LabMeeting092713.pptx
cadoyle, 28 September 2013
My objective today is to start working on my thesis preview presentation.
I put together a draft and sent it to Dr. Campbell. He sent me back some comments and a more concrete outline of how I should organize the presentation.
1) Define the problem with microbial production of drugs. Case study of theophylline from caffeine (used for asthma treatment) 2) Propose the solution of Programmed evolution but only at the conceptual level (tie selection pressure to production of desired compound). 3) Describe how fitness module should work (keep at conceptual level) 4) describe riboswtich function and contains aptamer (I have an animation in Keynote if you want to use that) 5) show how existing riboswitch works with GFP as reporter (show data) 6) Now bring in eCDM8 mechanism and desired outcome (show structures and loss of methyl groups) 7) Show that we never measured theophylline using riboswtich + GFP 8) Show possible problems of too much demethylation. (show structures of all family members) 9) Can we convert known aptamers into riboswitches? (show which two aptamers we are working with) 10) Your research goals: make two riboswitches from aptamers.
This gives you about 1 minute per slide = ten minutes.
Tomorrow I will make some corrections and talk to Dr. Campbell on Monday about more revisions.
Also, I wrote up two reviews of the speaker presentations for my thesis of visiting professors and submitted to Moodle to complete my thesis package.
cadoyle, 29 September 2013
My objective today is to edit presentation and design primers for cloning tetA fitness module downstream of ecdM8.
I designed primers and sent them to Dr. Campbell. File:EcdM8+TetAPrimers1.docx
Dr. Campbell and I will meet tomorrow to go over them.
cadoyle, 30 September 2013
My objective today is to work more on the presentation and work on trying to figure out how to get una-fold to print to the command line and not to a output file.
I looked online about how to get UNA-fold to print to the command line and found a paper by the authors. I am going to read the paper and play around with commands and the redirection of files to see I can simplify the process so I can use subcommand to call UNA-fold from the python script.
I talked to Dr. Campbell about the primers and we want to switch the direction the primers will operate. We want to clone ecdm8 downstream of tetA instead of the reverse. We used [[9]] to generate the primers.
The output from the program wasI checked the primers generated using this word file File:EcdM8+TetAPrimers.docx and sent them to Dr. Campbell for ordering.
Dr. Campbell gave me some slides and animations to use for the presentation. I will play around in combining what I made and he made to finish the presentation.
cadoyle, 1 October 2013
My objective today is to practice the presentation and read the paper about una-fold.
I meet with Dr. Campbell today we reviewed my presentation. The slides are set and I just need to practice. Dr. Campbell and I talked about the data that arrived from MWSU. MWSU had the construct where ecdm8 and the Riboswtich + tetA are in the same plasmid. However, they never got any growth in the presence of tetA. They cloned the riboswitch + tetA downswtream of ecdm8. The primers I designed clone ecdm8 downstream of tetA. It might make difference whether ecdM8 is upstream or downstream. When the primers arrive I will work on cloning ecdm8 downstream of the riboswitch + tetA. In the mean time I will test the construct MWSU designed J10011 to see if I can get expression. It is possible they used to much tetA in their experiment. From their data it seems that maybe having tetA fitness module on a different plasmid than ecdm8 might provide more tetA expression. I will test both constructs: 1) fitness module and ecdm8 on separate plasmids 2) fitness module and ecdm8 on the same plasmid.
Data from MWSU:
File:Powerpoint.pptx File:PlatePowerpoint.pptx
cadoyle, 2 October 2013
My objective today is start cultures of J10011 and J10140 + J119303 for testing ecdm8 with the tetA fitness module in the presence of theophylline.
I added 8ul of 25mM theophylline to a 2ml culture of Lb + AMP(high) and to a 2ml culture of Lb + AMP(high) + Chlor(low) to make 0.1mM theophylline + LB solution.
I inoculated the LB + Amp culture with J10011 (ecdm8 + tetA fitness module on same plasmid) [[10]] and LB + Amp + chlor with J110140 + J110130 [[11]].
I grew the cultures O/N at 37C. Tomorrow I will use a sterile loop to streak the cultures on tetA plates with various concentration of theophylline.
I read the paper on getting UNA-Fold to print to a different file or the command line. It was not very helpful. It wanted you to download a perl script. I believe UNA-fold already has it but will check tomorrow. I am not sure how to get UNA-Fold to print to the command line. I will play around with it tomorrow.
Also, I started working on my lab presentation for Friday. I took the data from MWSU we received on the 10-1-13 and made graphs so the data was easier to read. I also changed the figure legends from the part number to what was actually in the parts so it is easier to conceptualize.
cadoyle, 3 October 2013
My objective today is to streak out cultures on plates with theophylline and tetA to see if with fitness module there is expression.
Using a sterile loop I streaked cultures with J10011 and J110140+J119303 for colony isolation on plates with 10ug/ml of tetA and theophylline concentration ranging from 0-0.4mM.
I placed the plates in the incubator wrapped in foil O/N at 37C.
cadoyle, 4 October 2013
My objective today is to view the results of the colony isolation from yesterday and to take pictures. Also, will finish lab presentation.
Results: J10111 showed no growth at any concentration of Theophylline.
J190403 + J190303 (high promoter ecdm8 (low copy) + tetA fitness module ( high copy) showed growth on plates with 0.05-0.4mM of theophylline.
I think we should test 3-methlyxanthine and xanthine with the J190403 + J190303 construct and see if there is growth.
See lab presentation for pictures of growth.
cadoyle, 6 October 2013
I found a way to copy all the output from M-fold to a new file so I can sort through the file and look for delta G's lower than the energy needed for the apatmer to bind to a ligand. I can use doyle:Desktop catherinedoyle$ cat test2.txt >> test1.txt
I can use this command to copy all files to with dg.txt to a new file: cp *.txt newdir Then I can copy the file contents of each file into a new file. I can than sort the file for delta G's lower than the energy needed for the apatmer to bind to a ligand
I still need to figure out how to call it from the python script and how get spaces between the entries so you know what sequence gave what delta G.
cadoyle, 7 October 2013
My objective today is to practice my presentation for tomorrow an start cultures for testing the tetA fitness module with caffeine, 3-methylxanthine, and xanthine.
I inoculated a 2ml Lb AMP + Chlor culture with J110140+J119303 with 8ul from box 2-4 #93. I grew the culture O/N at 37C shaking.
cadoyle, 8 October 2013
Today I am giving my thesis preview presentation. File:DoylePreview1.ppt
Also, I used a sterile loop and plated the culture of J110140+J119303 on Lb tet, LB tet + Caffeine, LB tet + 3-methlyxanthine, LB tet + xanthine. I covered the plates in foil and placed in the 37C incubator O/N. Tomorrow I will look for growth to see if the riboswitch can detect 3-methlyxanthine and xanthine.
Dr. Campbell and I meet and we discussed that we need to place ecdm8 downstream of teta fitness module so when gst9 arrives we can clone it into the construct and be ready to test the construct in programmed evolution. I will start on this week and finish after fall break. I will also try to work on the program and have questions for Dr. Heyer on Friday.
cadoyle, 9 October 2013
My objective today is to check the results of the experiment yesterday and see if there is cell growth.
I check the plates. None of the plates showed cell growth. I forgot to do a positive control with theophylline + tetA so will redo the experiment with the positive control.
I inoculated a 2ml Lb AMP + Chlor culture with J110140+J119303 with 8ul from box 2-4 #93. I grew the culture O/N at 37C shaking.
Also, I inoculated a 2ml LB + Amp culture with j119140 and one 2mL LB = AMp culture with J119303. I grew the culture O/N at 37C shaking. Tomorrow I will miniprep and the DNA so I can start PCR.
cadoyle, 10 October 2013
I minipreped the cultures of J119140 and J119303 following this protocol [File:http://www.bio.davidson.edu/courses/Molbio/Protocols/Zippy_MiniPrep.html].
I nanodroped the DNA and got the following results: J119140: 717.92ng/ul A260=14.25 A280= 7.569 260/280 = 1.90 260/230=2.19 J119303: 211.90ng/ul A260=4.238 A280= 2.226 260/280 = 1.90 260/230=2.21
Next, I will perform PCR with J119140 and J119303 to prepare for GGA.
PCR in preparation for GGA: J110140 Master mix 50ul FWD Primer 1ul REV Primer 1ul DNA 1ul Water 47ul
J119303 Master mix 50ul FWD Primer 1ul REV Primer 1ul DNA 1ul Water 47ul
PCR Cycle for J110140 Step 1: 95° C 5 minutes (denature template) Step 2: 95° C 30 seconds (denature dsDNA) Step 3: 61° C 30 seconds (Tm minus 5 degrees) Step 4: 72° C 3 minutes Step 5: Repeat Steps 2 through 4, 29 more times Step 6: Store at RT°
PCR Cycle for J119303 Step 1: 95° C 5 minutes (denature template) Step 2: 95° C 30 seconds (denature dsDNA) Step 3: 57° C 30 seconds (Tm minus 5 degrees) Step 4: 72° C 1 minutes Step 5: Repeat Steps 2 through 4, 29 more times Step 6: Store at RT°
After pCR I removed the tubes and stored in the fridge for GGA after fall break
Also, I used a sterile loop and plated the culture of J110140+J119303 on Lb tet, LB tet + Caffeine, LB tet + 3-methlyxanthine, LB tet + xanthine, and LB tet + theophyyline. I covered the plates in foil and placed in the 37C incubator O/N. Tomorrow I will look for growth to see if the riboswitch can detect 3-methlyxanthine and xanthine.
cadoyle, 11 October 2013
I looked at the plate experiment from yesterday the results are:
Tet +Theophylline = lots of growth
Tet + caffeine = 1 colony
Tet + 3methyl = no growth
Tet + xanthine = no growth
Tet= no growth
It is possible that the concentration of 3-methylxanthine and xanthine needs to be higher in plates than in liquid culture. At .1mM we saw GFP expression in liquid culture but it could vary for tetA. I am not sure if the colony on Tet + caffeine is showing that Tet degraded or if the cells were able to make theophylline? The negative control showed no growth indicating Tet is working. Therefore, I would presume that we have a strain of e.coli that mutated to make theophylline. I will grow up the colony and test it again on plates with caffeine plus tetA to see if can grow.
I took the colony from the plate with caffeine and plated on a Tet, Tet + Theophylline plate to save it and on a Tet + caffeine plate to see if it can really grow. I will leave it over the weekend at room temperature.
Also, we got an email from the lab that is providing caffeine addicted cells. Hi Malcolm,
MTA done! -- We'll send you the guaB + pDCAF3 strain as a stab next week. You'll want to grow it in the minimal media supplemented with caffeine and antibiotic at 30°C as described in the ACS Synthetic Biology paper. We sometimes get inconsistent results after growing without caffeine or at 37°C (likely due to the enzymes from soil not being stable at 37°C or due to mutations). If you have any other questions about the strain or run into problems using it, you can get in touch with Erik Quandt, the graduate student who led the study (who I am CC'ing to correct any details I may have wrong).
Best, --Jeff
It is possible that ecdM8 is unstable at 37C and that is why we don't see growth!
I took the culture from 10-10-13 and plated the cells on Tet, Tet + caffeine and Tet + theophylline and will let grow over the weekend at room temperature.
Lab Presentation for the week File:LabMeeting10-11-13.pptx
cadoyle, 16 October 2013
I examined the plates that grew over fall break. Tet - growth Tet + Theophylline - growth Tet + Caffeine - growth
This indicates that there is contamination or the tetA resistance is gone.
For pictures see lab meeting presentation 10-18-13
MoWest sent data indicating that the concentration of Caffeine should be higher. I will try the experiment again at room temperature but with 1mM Caffeine plates.
The results from the colony that grew on caffeine + Tet on 10-11-13: Tet- growth Tet + theophylline-growth Tet=Caffeine-growth
This indicates that the strain is making theophylline but a mutant that evolved to be resistant to Tet.
I realized that J40 is in psB1A2 and not psB1A8 this means that GGA might not work since psB1A2 has bsa I site. I will go ahead and try GGA to see if it will work but will also start working on cloning J40 into psB1A8.
GGA I performed GGA following this protocol [12]
| Neg control (J40) | J40 + J303 | |
|---|---|---|
| dh20 | 6ul | 5ul |
| J40 | 1ul | 1ul |
| 10X ligation buffer | 1ul | 1ul |
| KoAC | 1ul | 1ul |
| BsaI | 0.5ul | 0.5ul |
| T4 ligase | 0.5ul | 0.5ul |
| J303 | 0.5 | 1ul |
| Total | 10ul | 10ul |
PCR Cycles: 20 cycles of 37C for 1min and 16C for 1min hold 22C
Digestion fo J40 (Insert) and J303(has psb1A8)
| J40 | J303 | |
|---|---|---|
| DNA | 3ul | 3ul |
| dH20 | 13ul | 13ul |
| 10X ligation buffer | 2ul | 2ul |
| EcoRI | 1ul | 1ul |
| Pst | 1ul | 1ul |
| Total | 20ul | 20ul |
Incubated for 3 hours at 37C
I started a 2mlLB = AMp + Chlor culture of J40 + J303 and grew o/n at 37 C shaking.
Also, I edited my proposal: File:DoyleThesisProposal.doc
cadoyle, 17 October 2013
I made a .4% gel with 0.5X TBE and ran the digestion of J303 for 45 minutes. I cut out the band around 2100kb and saved for gel purification.
I plated the culture of J40 and j303 with a sterile loop on Tet, Tet + Theo (0.4mM) and Tet + Caffeine (1mM). I incubated at room temperature o/n
I transformed GGA product following the protocol [13]
I plated on LB + Amp and grew o/n at 37C
cadoyle, 18 October 2013
I looked at the transformation with GGA. There were lots of colonies. I am not sure the transformation worked. I performed colony PCR with 2 controls and 10 experimental following this protocol. [14]
I looked at that experiment with J40 + J303 plated on Tet, Tet + Theo, Tet + Caff. There was no growth on any plates. So, I put the plates in 30C incubator. I will check the plates on Sunday for growth.
I made a 0.4% agarose gel and ran the colony PCR on the gel as well as J404 from digestion.